PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G228600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family DBB
Protein Properties Length: 260aa    MW: 27804.2 Da    PI: 4.6031
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G228600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.11.5e-07446541
            zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                         C+ +e   ++  C  ++  lC+ C +e+H        H++ p
  Sevir.1G228600.1.p  4 QCDACEGAAATVVCCADEAALCARCDVEIHAAnklaskHQRLP 46
                        7******99*********************6678888888877 PP

2zf-B_box279.3e-095485334
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeH 34
                         ++C+ ++ek + +fC +++ l+C+dC + +H
  Sevir.1G228600.1.p 54 LPRCDVCQEKAAFIFCVEDRALFCRDCDEPIH 85
                        689**************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.011147IPR000315B-box-type zinc finger
CDDcd000212.22E-6347No hitNo description
PfamPF006431.2E-5447IPR000315B-box-type zinc finger
SMARTSM003362.1E-9447IPR000315B-box-type zinc finger
SMARTSM003364.6E-145299IPR000315B-box-type zinc finger
PROSITE profilePS501198.9025299IPR000315B-box-type zinc finger
PfamPF006431.7E-65495IPR000315B-box-type zinc finger
CDDcd000215.41E-75585No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010100Biological Processnegative regulation of photomorphogenesis
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MKIQCDACEG AAATVVCCAD EAALCARCDV EIHAANKLAS KHQRLPLEAL SARLPRCDVC  60
QEKAAFIFCV EDRALFCRDC DEPIHVPGTL SGNHQRYLAT GIRVGAASTC SAGGCDAHDS  120
DHHAPPKATV EPPQQPAVSA EAQQVPSPPQ FLPQGWAVDE LLQFSDYESG DKLQKESPLG  180
FKELEWFADI DLFHDQAAPK AGRTLAEVPE LFGSQAASDA AYYRPSKAAG AGAGVRQNKK  240
ARIEVTDDEE DYLIVPDLG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0395860.0BT039586.1 Zea mays full-length cDNA clone ZM_BFc0031F03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953029.10.0PREDICTED: B-box zinc finger protein 25-like
SwissprotQ9SID16e-80BBX25_ARATH; B-box zinc finger protein 25
TrEMBLC5XX801e-158C5XX80_SORBI; Putative uncharacterized protein Sb04g025400
STRINGSb04g025400.11e-157(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32023368
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31380.14e-81salt tolerance homologue